Kayseri evden eve nakliyat,alanında şehir içi nakliyat, Şehirler arası evden eve taşıma. ve taşımacılık., ve kayseri nakliyeciler.

4.75 Rating by CuteStat

emniyetevdenevenakliyat.com is 1 decade 1 year old. It is a domain having com extension. It has a global traffic rank of #6939377 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, emniyetevdenevenakliyat.com is SAFE to browse.

PageSpeed Score
90
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 121
Daily Pageviews: 242

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 704
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 450
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 6,939,377
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

94.199.200.87

Hosted Country:

Türkiye TR

Location Latitude:

41.0484

Location Longitude:

29.0156

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 17 H2 Headings: 17
H3 Headings: 5 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 8
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 94.199.200.87)

Amargi Dergi | 3 aylık Feminist Dergi

- amargidergi.com
9,446,032 $ 240.00

Kayseri Evden Eve Nakliyat | Kayseri Ev Taşıma firmaları

- kayserievdenevenakliyatfirmalari.com

Kayseri evden eve nakliyat, sektörü; şehir içi ev taşıma, şehirler arası nakliye hizmetleri sağlayan eşya taşıma ve nakliyat firmalar için tıklayın.

8,137,110 $ 240.00

Index of /

- mersindoguakdeniztemsilciligi.com
Not Applicable $ 8.95

vBulletin 4.2.0 Install System

- audiclubtr.com
Not Applicable $ 8.95

Özcanlar Mermer Granit | Yapı Malzemeleri

- ozcanlarmermergranit.com

Özcanlar Mermer Granit, güler yüzlü hizmet, güven ve kalitenin adresi

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Connection: close
X-Powered-By: PHP/7.3.12
Content-Type: text/html; charset=UTF-8
Link: <https://www.emniyetevdenevenakliyat.com/wp-json/>; rel="https://api.w.org/"
Cache-Control: public, max-age=15552000
Expires: Mon, 22 Jun 2020 18:37:42 GMT
Transfer-Encoding: chunked
Content-Encoding: gzip
Vary: Accept-Encoding
Date: Wed, 25 Dec 2019 18:37:42 GMT

Domain Information

Domain Registrar: IHS Telekom, Inc
Registration Date: Aug 24, 2012, 9:48 PM 1 decade 1 year 8 months ago
Expiration Date: Aug 24, 2022, 9:48 PM 1 year 8 months 3 weeks ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
cpns1.turhost.com 37.230.110.110 Türkiye Türkiye
cpns2.turhost.com 37.230.111.111 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
emniyetevdenevenakliyat.com A 10798 IP: 94.199.200.87
emniyetevdenevenakliyat.com NS 86400 Target: cpns1.turdns.com
emniyetevdenevenakliyat.com NS 86400 Target: cpns2.turdns.com
emniyetevdenevenakliyat.com SOA 10800 MNAME: cpns1.turdns.com
RNAME: csf.ofis.net
Serial: 2019120901
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
emniyetevdenevenakliyat.com MX 14400 Target: emniyetevdenevenakliyat.com
emniyetevdenevenakliyat.com TXT 14400 TXT: v=spf1 ip4:94.199.200.85 +a +mx
+ip4:176.53.69.201 ~all

Similarly Ranked Websites

Forexbbc.com

- forexbbc.com

Encuentra lo basico que debes saber antes de entrar en el mercado Forex, tambien manuales de exito, trader

6,939,393 $ 8.95

TheChiliCool Fashion Blog Italia - Fashion Blogger italiane moda Itali

- thechilicool.com

Fashion Blogger italiane moda Italia

6,939,402 $ 240.00

Cybermedia Television BV

- cymtv.com
6,939,403 $ 240.00

Custom Web Design Agency UK | The Startup Guys

- thestartupguys.co.uk

Web Design Agency offers affordable web design solutions. Custom website design done by professionals.

6,939,407 $ 240.00

Dummy Site

- sheehanmarketingwipsites.com
6,939,408 $ 8.95

Full WHOIS Lookup

Domain Name: EMNIYETEVDENEVENAKLIYAT.COM
Registry Domain ID: 1740536715_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.wishnames.com
Registrar URL: www.ihs.com.tr
Updated Date: 2019-08-13T08:24:39Z
Creation Date: 2012-08-24T16:03:23Z
Registrar Registration Expiration Date: 2022-08-24T16:03:23Z
Registrar: IHS Telekom, Inc
Registrar IANA ID: 1091
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: resul
Registrant Organization: resul
Registrant Street: resul
Registrant City: Istanbul
Registrant State/Province:
Registrant Postal Code: 34744
Registrant Country: TR
Registrant Phone: +90.5545309748
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: hizmetnakliyat@hotmail.com
Registry Admin ID: Not Available From Registry
Admin Name: resul
Admin Organization: resul
Admin Street: resul
Admin City: Istanbul
Admin State/Province:
Admin Postal Code: 34744
Admin Country: TR
Admin Phone: +90.5545309748
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: hizmetnakliyat@hotmail.com
Registry Tech ID: Not Available From Registry
Tech Name: resul
Tech Organization: resul
Tech Street: resul
Tech City: Istanbul
Tech State/Province:
Tech Postal Code: 34744
Tech Country: TR
Tech Phone: +90.5545309748
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: hizmetnakliyat@hotmail.com
Name Server: cpns1.turhost.com
Name Server: cpns2.turhost.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse@ihs.com.tr
Registrar Abuse Contact Phone: +902165460056
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-25T18:37:58Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: IHS TELEKOM INC

The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is IHS Telekom, Inc.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.